PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D03G1006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 285aa    MW: 32227.7 Da    PI: 6.4104
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D03G1006genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.44e-141257146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqk 46
                     +g+WT eEde+l ++vk++G++ W++I r mg + Rt+k+c++rw +
      Gh_D03G1006 12 KGPWTGEEDEILMNYVKKYGPKGWSSI-RSMGlLPRTGKSCRLRWVN 57
                     79************************9.6777788**********87 PP

2Myb_DNA-binding45.41.9e-1468107344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      ++++eE+   +++ +++G++ W++Iar+++ gRt++++k++w
      Gh_D03G1006  68 KFSAEEERVVIELQAEFGNK-WAKIARHLP-GRTDNDVKNFW 107
                      79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.312759IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-21860IPR009057Homeodomain-like
SuperFamilySSF466892.34E-2910107IPR009057Homeodomain-like
SMARTSM007174.8E-121161IPR001005SANT/Myb domain
PfamPF002495.5E-121257IPR001005SANT/Myb domain
CDDcd001671.00E-111459No hitNo description
PROSITE profilePS5129421.28860115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-1861113IPR009057Homeodomain-like
SMARTSM007171.4E-1265113IPR001005SANT/Myb domain
CDDcd001671.40E-1168107No hitNo description
PfamPF002491.2E-1268107IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MERQSDGTFI KKGPWTGEED EILMNYVKKY GPKGWSSIRS MGLLPRTGKS CRLRWVNKLR  60
PNLKTGCKFS AEEERVVIEL QAEFGNKWAK IARHLPGRTD NDVKNFWSAR RKRLERISHT  120
PKSKGKDHHA LHEMPMVEVV PSNGVPLEQG SSSHQHPFFP GNLEEFKLVP LPDLIKPDFL  180
NMETGLSTLD IEPIRMIPQL QVDLPILPDS FDFNFAAMFN NQEASESESK PISLTKIPSA  240
GIKGSDAELG KKENIGNSAT PDSFFDEFPT DMFDCLEPLV SSSEW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-271011325126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012470997.10.0PREDICTED: transcription factor MYB23-like
TrEMBLA0A0D2RKK90.0A0A0D2RKK9_G
STRINGVIT_15s0021g02040.t012e-81(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2229145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.13e-64MYB family protein